Lineage for d2pe5c1 (2pe5 C:2-61)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1732724Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 1732725Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 1732999Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 1733015Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 1733016Species Escherichia coli [TaxId:562] [47442] (14 PDB entries)
  8. 1733022Domain d2pe5c1: 2pe5 C:2-61 [149396]
    Other proteins in same PDB: d2pe5a2, d2pe5b2, d2pe5c2
    automatically matched to d1cjga_
    protein/DNA complex; complexed with 145

Details for d2pe5c1

PDB Entry: 2pe5 (more details), 3.5 Å

PDB Description: crystal structure of the lac repressor bound to onpg in repressed state
PDB Compounds: (C:) lactose operon repressor

SCOPe Domain Sequences for d2pe5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pe5c1 a.35.1.5 (C:2-61) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql

SCOPe Domain Coordinates for d2pe5c1:

Click to download the PDB-style file with coordinates for d2pe5c1.
(The format of our PDB-style files is described here.)

Timeline for d2pe5c1: