Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.1: L-arabinose binding protein-like [53823] (17 proteins) |
Protein Lac-repressor (lacR) core (C-terminal domain) [53837] (1 species) |
Species Escherichia coli [TaxId:562] [53838] (11 PDB entries) |
Domain d2pe5b2: 2pe5 B:62-329 [149395] Other proteins in same PDB: d2pe5a1, d2pe5b1, d2pe5c1 automatically matched to d1jyea_ protein/DNA complex; complexed with 145 |
PDB Entry: 2pe5 (more details), 3.5 Å
SCOPe Domain Sequences for d2pe5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pe5b2 c.93.1.1 (B:62-329) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv drllqlsqgqavkgnqllpvslvkrktt
Timeline for d2pe5b2:
View in 3D Domains from other chains: (mouse over for more information) d2pe5a1, d2pe5a2, d2pe5c1, d2pe5c2 |