SCOPe 2.08: Domain d2pblc2: 2pbl C:1-261

Lineage for d2pblc2 (2pbl C:1-261)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Uncharacterized protein TM1040_2492 [159734] (1 species)

7. Species Silicibacter sp. tm1040 [TaxId:292414] [159735] (1 PDB entry)
   Uniprot Q1GDP2 1-261

8. Domain d2pblc2: 2pbl C:1-261 [149369]
   Other proteins in same PDB: d2pbla2, d2pblb3, d2pblc3, d2pbld3
   automated match to d2pbla1
   complexed with cl, mg, po4, unl

Details for d2pblc2

PDB Entry: 2pbl, 1.79 Å

PDB Description: crystal structure of a putative thioesterase (tm1040_2492) from silicibacter sp. tm1040 at 1.79 a resolution

PDB Compounds: (C:) Putative esterase/lipase/thioesterase

SCOPe Domain Sequences for d2pblc2:

Sequence; same for both SEQRES and ATOM records:

>d2pblc2 c.69.1.2 (C:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]}
melddayangayiegaadypprwaasaedfrnslqdrarlnlsygegdrhkfdlflpegt
pvglfvfvhggywmafdksswshlavgalskgwavampsyelcpevriseitqqisqavt
aaakeidgpivlaghsagghlvarmldpevlpeavgarirnvvpisplsdlrpllrtsmn
ekfkmdadaaiaespvemqnrydakvtvwvggaerpafldqaiwlveawdadhviafekh
hfnviepladpesdlvavita

Timeline for d2pblc2:

• d2pblc2 first appeared in SCOP 1.75, called d2pblc1
  
• d2pblc2 appears in SCOPe 2.07