Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.2: Carboxylesterase [53487] (7 proteins) |
Protein Uncharacterized protein TM1040_2492 [159734] (1 species) |
Species Silicibacter sp. tm1040 [TaxId:292414] [159735] (1 PDB entry) Uniprot Q1GDP2 1-261 |
Domain d2pbld2: 2pbl D:1-261 [149370] Other proteins in same PDB: d2pbla2, d2pblb3, d2pblc3, d2pbld3 automated match to d2pbla1 complexed with cl, mg, po4, unl |
PDB Entry: 2pbl (more details), 1.79 Å
SCOPe Domain Sequences for d2pbld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pbld2 c.69.1.2 (D:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} melddayangayiegaadypprwaasaedfrnslqdrarlnlsygegdrhkfdlflpegt pvglfvfvhggywmafdksswshlavgalskgwavampsyelcpevriseitqqisqavt aaakeidgpivlaghsagghlvarmldpevlpeavgarirnvvpisplsdlrpllrtsmn ekfkmdadaaiaespvemqnrydakvtvwvggaerpafldqaiwlveawdadhviafekh hfnviepladpesdlvavita
Timeline for d2pbld2: