![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
![]() | Protein dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA [159287] (1 species) |
![]() | Species Aneurinibacillus thermoaerophilus [TaxId:143495] [159288] (4 PDB entries) Uniprot Q6T1W8 1-136! Uniprot Q6T1W8 2-136 |
![]() | Domain d2pa7a1: 2pa7 A:2-136 [149339] complexed with cl, edo, tyd |
PDB Entry: 2pa7 (more details), 1.5 Å
SCOPe Domain Sequences for d2pa7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} enkvinfkkiidsrgslvaieenknipfsikrvyyifdtkgeeprgfhahkkleqvlvcl ngscrvilddgniiqeitldspavglyvgpavwhemhdfssdcvmmvlasdyydetdyir qydnfkkyiakinle
Timeline for d2pa7a1: