Lineage for d2p7vb_ (2p7v B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1477565Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1480774Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1480807Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1480815Protein Sigma70 (SigA, RpoD) [88666] (4 species)
  7. 1480816Species Escherichia coli [TaxId:562] [116816] (2 PDB entries)
    Uniprot P00579 546-613
  8. 1480817Domain d2p7vb_: 2p7v B: [149292]
    automated match to d1tlhb_
    complexed with mg

Details for d2p7vb_

PDB Entry: 2p7v (more details), 2.6 Å

PDB Description: Crystal structure of the Escherichia coli regulator of sigma 70, Rsd, in complex with sigma 70 domain 4
PDB Compounds: (B:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2p7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7vb_ a.4.13.2 (B:) Sigma70 (SigA, RpoD) {Escherichia coli [TaxId: 562]}
dvlagltareakvlrmrfgidmntdytleevgkqfdvtrerirqieakalrklrhpsrse
vlrsfldd

SCOPe Domain Coordinates for d2p7vb_:

Click to download the PDB-style file with coordinates for d2p7vb_.
(The format of our PDB-style files is described here.)

Timeline for d2p7vb_: