Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.41: UbiE/COQ5-like [110671] (5 proteins) Pfam PF01209 |
Protein Hypothetical protein ECA1738 [159682] (1 species) |
Species Erwinia carotovora [TaxId:554] [159683] (2 PDB entries) Uniprot Q6D6E7 21-249 |
Domain d2p7hc_: 2p7h C: [149283] automated match to d2p7ha1 complexed with cl, edo, na, trs |
PDB Entry: 2p7h (more details), 1.85 Å
SCOPe Domain Sequences for d2p7hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7hc_ c.66.1.41 (C:) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} ynfdfdvmhpfmvraftpffrpgnllelgsfkgdftsrlqehfnditcveaseeaishaq grlkdgityihsrfedaqlprrydnivlthvlehiddpvallkrinddwlaeggrlflvc pnanavsrqiavkmgiishnsavteaefahghrctyaldtlerdasraglqvtyrsgiff kalanfqwdqilqtdilskeyldgcyqlgqqypdlcasifllcekginq
Timeline for d2p7hc_: