Class b: All beta proteins [48724] (174 folds) |
Fold b.106: Phage tail proteins [69278] (1 superfamily) core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel |
Superfamily b.106.1: Phage tail proteins [69279] (3 families) |
Family b.106.1.1: Baseplate protein-like [69280] (3 proteins) duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions |
Protein Hypothetical protein c3393 [159177] (1 species) probable phage-related protein; similar to fusion of the T4 phage gp27 and (a part of) gp5 |
Species Escherichia coli o6 [TaxId:217992] [159178] (1 PDB entry) Uniprot Q8FED2 15-201! Uniprot Q8FED2 202-377 |
Domain d2p5zx2: 2p5z X:15-201 [149264] Other proteins in same PDB: d2p5zx1 |
PDB Entry: 2p5z (more details), 2.6 Å
SCOPe Domain Sequences for d2p5zx2:
Sequence, based on SEQRES records: (download)
>d2p5zx2 b.106.1.1 (X:15-201) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]} hklkirglqspvdvltfegreqlstpfrydiqftssdkaiapesvlmqdgafsltappvq gmpvqtalrtlhgvitgfkhlsssqdearyevrleprmalltrsrqnaiyqnqtvpqive kilrerhqmrgqdfvfnlkseypareqvmqygeddltfvsrllsevgiwfrfatdarlki eviefyd
>d2p5zx2 b.106.1.1 (X:15-201) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]} hklkirglqspvdvltfegreqlstpfrydiqftssdkaiapesvlmqdgafsltaalrt lhgvitgfkhlsssqdearyevrleprmalltrsrqnaiyqnqtvpqivekilrerhqmr gqdfvfnlkseypareqvmqygeddltfvsrllsevgiwfrfatdarlkieviefyd
Timeline for d2p5zx2: