Lineage for d2p5zx2 (2p5z X:15-201)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820941Fold b.106: Phage tail proteins [69278] (1 superfamily)
    core: barrel; n=6, S=10; greek-key; topologically similar to the FMN-binding split barrel
  4. 2820942Superfamily b.106.1: Phage tail proteins [69279] (4 families) (S)
  5. 2820943Family b.106.1.1: Baseplate protein-like [69280] (4 proteins)
    duplication: consists of two similar barrel domains that differ by the first strand directions; the barrels are differently decorated by alpha+beta insertions
  6. 2820978Protein Hypothetical protein c3393 [159177] (1 species)
    probable phage-related protein; similar to fusion of the T4 phage gp27 and (a part of) gp5
  7. 2820979Species Escherichia coli o6 [TaxId:217992] [159178] (1 PDB entry)
    Uniprot Q8FED2 15-201! Uniprot Q8FED2 202-377
  8. 2820980Domain d2p5zx2: 2p5z X:15-201 [149264]
    Other proteins in same PDB: d2p5zx1

Details for d2p5zx2

PDB Entry: 2p5z (more details), 2.6 Å

PDB Description: the e. coli c3393 protein is a component of the type vi secretion system and exhibits structural similarity to t4 bacteriophage tail proteins gp27 and gp5
PDB Compounds: (X:) Type VI secretion system component

SCOPe Domain Sequences for d2p5zx2:

Sequence, based on SEQRES records: (download)

>d2p5zx2 b.106.1.1 (X:15-201) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
hklkirglqspvdvltfegreqlstpfrydiqftssdkaiapesvlmqdgafsltappvq
gmpvqtalrtlhgvitgfkhlsssqdearyevrleprmalltrsrqnaiyqnqtvpqive
kilrerhqmrgqdfvfnlkseypareqvmqygeddltfvsrllsevgiwfrfatdarlki
eviefyd

Sequence, based on observed residues (ATOM records): (download)

>d2p5zx2 b.106.1.1 (X:15-201) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
hklkirglqspvdvltfegreqlstpfrydiqftssdkaiapesvlmqdgafsltaalrt
lhgvitgfkhlsssqdearyevrleprmalltrsrqnaiyqnqtvpqivekilrerhqmr
gqdfvfnlkseypareqvmqygeddltfvsrllsevgiwfrfatdarlkieviefyd

SCOPe Domain Coordinates for d2p5zx2:

Click to download the PDB-style file with coordinates for d2p5zx2.
(The format of our PDB-style files is described here.)

Timeline for d2p5zx2: