Lineage for d2p5zx1 (2p5z X:378-468)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1542673Superfamily b.40.8: gp5 N-terminal domain-like [69255] (1 family) (S)
  5. 1542674Family b.40.8.1: gp4 N-terminal domain-like [69256] (2 proteins)
  6. 1542675Protein Hypothetical protein c3393 [159082] (1 species)
  7. 1542676Species Escherichia coli o6 [TaxId:217992] [159083] (1 PDB entry)
    Uniprot Q8FED2 378-468
  8. 1542677Domain d2p5zx1: 2p5z X:378-468 [149263]
    Other proteins in same PDB: d2p5zx2, d2p5zx3

Details for d2p5zx1

PDB Entry: 2p5z (more details), 2.6 Å

PDB Description: the e. coli c3393 protein is a component of the type vi secretion system and exhibits structural similarity to t4 bacteriophage tail proteins gp27 and gp5
PDB Compounds: (X:) Type VI secretion system component

SCOPe Domain Sequences for d2p5zx1:

Sequence, based on SEQRES records: (download)

>d2p5zx1 b.40.8.1 (X:378-468) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
rpvmagtlparvtstvkndiyahidkdgryrvnldfdrdtwkpgyeslwvrqsrpyagdt
yglhlpllagtevsiafeegnpdrpyiagvk

Sequence, based on observed residues (ATOM records): (download)

>d2p5zx1 b.40.8.1 (X:378-468) Hypothetical protein c3393 {Escherichia coli o6 [TaxId: 217992]}
rpvmagtlparvtsdiyahidkdgryrvnldfrdtwkpgyeslwvrllagtevsiafeeg
npdrpyiagvk

SCOPe Domain Coordinates for d2p5zx1:

Click to download the PDB-style file with coordinates for d2p5zx1.
(The format of our PDB-style files is described here.)

Timeline for d2p5zx1: