Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) forms trimers with three closely packed beta-sheets |
Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein) automatically mapped to Pfam PF02863 |
Protein C-terminal domain of arginine repressor [55254] (3 species) |
Species Bacillus subtilis [TaxId:1423] [69759] (2 PDB entries) |
Domain d2p5mc_: 2p5m C: [149256] automated match to d1b4ba_ complexed with arg |
PDB Entry: 2p5m (more details), 1.95 Å
SCOPe Domain Sequences for d2p5mc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5mc_ d.74.2.1 (C:) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]} nplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtili icrtpedtegvknrllell
Timeline for d2p5mc_: