SCOPe 2.07: Domain d2p5mc_: 2p5m C:

Lineage for d2p5mc_ (2p5m C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.74: DCoH-like [55247] (5 superfamilies)
   beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta

4. Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families)
   forms trimers with three closely packed beta-sheets

5. Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
   automatically mapped to Pfam PF02863

6. Protein C-terminal domain of arginine repressor [55254] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [69759] (2 PDB entries)

8. Domain d2p5mc_: 2p5m C: [149256]
   automated match to d1b4ba_
   complexed with arg

Details for d2p5mc_

PDB Entry: 2p5m, 1.95 Å

PDB Description: c-terminal domain hexamer of ahrc bound with l-arginine

PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d2p5mc_:

Sequence; same for both SEQRES and ATOM records:

>d2p5mc_ d.74.2.1 (C:) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]}
nplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddtili
icrtpedtegvknrllell

Timeline for d2p5mc_:

• d2p5mc_ first appeared in SCOP 1.75, called d2p5mc1
  
• d2p5mc_ appears in SCOPe 2.06
  
• d2p5mc_ appears in the current release, SCOPe 2.08