![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily) pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns |
![]() | Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) ![]() this domain is interrupted by the catalytic beta/alpha barrel domain |
![]() | Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein) |
![]() | Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [141688] (4 PDB entries) Uniprot P0AF18 1-53,351-382 |
![]() | Domain d2p53b1: 2p53 B:1-53,B:351-382 [149233] Other proteins in same PDB: d2p53a2, d2p53b2 automatically matched to d1ymya1 complexed with nng, zn; mutant |
PDB Entry: 2p53 (more details), 2.1 Å
SCOPe Domain Sequences for d2p53b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p53b1 b.92.1.5 (B:1-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]} myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk vanltaftpdfkitktivngnevvtq
Timeline for d2p53b1: