Lineage for d2p53a2 (2p53 A:54-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2833366Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2833879Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
    automatically mapped to Pfam PF01979
  6. 2833880Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)
  7. 2833884Species Escherichia coli [TaxId:562] [141808] (4 PDB entries)
    Uniprot P0AF18 54-350
  8. 2833887Domain d2p53a2: 2p53 A:54-350 [149232]
    Other proteins in same PDB: d2p53a1, d2p53b1
    automatically matched to d1ymya2
    complexed with nng, zn; mutant

Details for d2p53a2

PDB Entry: 2p53 (more details), 2.1 Å

PDB Description: crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate
PDB Compounds: (A:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2p53a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p53a2 c.1.9.10 (A:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrv
mreylakhpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlap
emvpaevisklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglag
aildeadiycgiiadglhvdyanirnakrlkgdklclvtnatapaganieqfifagktiy
yrnglcvdengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlg

SCOPe Domain Coordinates for d2p53a2:

Click to download the PDB-style file with coordinates for d2p53a2.
(The format of our PDB-style files is described here.)

Timeline for d2p53a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p53a1