SCOPe 2.08: Domain d2p4xb_: 2p4x B:

Lineage for d2p4xb_ (2p4x B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.381: ATP12-like [160908] (1 superfamily)
   contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices

4. Superfamily d.381.1: ATP12-like [160909] (1 family)

5. Family d.381.1.1: ATP12-like [160910] (2 proteins)
   Pfam PF07542; F1-ATPase chaperone

6. Protein ATP12 ATPase [160913] (1 species)

7. Species Paracoccus denitrificans [TaxId:266] [160914] (3 PDB entries)
   Uniprot A1B060 2-235! Uniprot A1B060 3-235

8. Domain d2p4xb_: 2p4x B: [149220]
   automated match to d2zd2a1

Details for d2p4xb_

PDB Entry: 2p4x, 1.9 Å

PDB Description: Crystal Structure of Atp12 from Paracoccus Denitrificans

PDB Compounds: (B:) ATP12 ATPase

SCOPe Domain Sequences for d2p4xb_:

Sequence; same for both SEQRES and ATOM records:

>d2p4xb_ d.381.1.1 (B:) ATP12 ATPase {Paracoccus denitrificans [TaxId: 266]}
ewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevid
pnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdplid
waatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilglav
irgridaptahalsrideefqaerwgrdeeaeaqaasrlaamrdserfwhltr

Timeline for d2p4xb_:

• d2p4xb_ first appeared in SCOP 1.75, called d2p4xb1
  
• d2p4xb_ appears in SCOPe 2.07