Lineage for d2p3la_ (2p3l A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501329Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2501330Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 2501331Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (8 PDB entries)
    Uniprot P12823 2495-2756
  8. 2501333Domain d2p3la_: 2p3l A: [149180]
    automated match to d1l9ka_
    complexed with cit, g3a, gol, sah, so4

Details for d2p3la_

PDB Entry: 2p3l (more details), 2.2 Å

PDB Description: Crystal Structure of Dengue Methyltransferase in Complex with GpppA and S-Adenosyl-L-Homocysteine
PDB Compounds: (A:) type II methyltransferase

SCOPe Domain Sequences for d2p3la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3la_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2) [TaxId: 12637]}
tlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfve
rnlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrlq
sgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpym
ssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmrh
kkatyepdvdlgsgtrn

SCOPe Domain Coordinates for d2p3la_:

Click to download the PDB-style file with coordinates for d2p3la_.
(The format of our PDB-style files is described here.)

Timeline for d2p3la_: