Lineage for d2p2ta1 (2p2t A:3-89)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201651Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 1201652Superfamily d.39.1: DLC [54648] (1 family) (S)
  5. 1201653Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 1201654Protein Dynein light chain 1 (DLC1) [54650] (3 species)
    synonym: PIN, a protein inhibitor of neuronal nitric oxide synthase
  7. 1201655Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102918] (8 PDB entries)
  8. 1201673Domain d2p2ta1: 2p2t A:3-89 [149172]
    automatically matched to d1rhwa_
    complexed with act, na

Details for d2p2ta1

PDB Entry: 2p2t (more details), 3 Å

PDB Description: crystal structure of dynein light chain lc8 bound to residues 123-138 of intermediate chain ic74
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d2p2ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p2ta1 d.39.1.1 (A:3-89) Dynein light chain 1 (DLC1) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
drkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrnf
gsyvthetrhfiyfylgqvaillfksg

SCOPe Domain Coordinates for d2p2ta1:

Click to download the PDB-style file with coordinates for d2p2ta1.
(The format of our PDB-style files is described here.)

Timeline for d2p2ta1: