Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
Protein Collagenase-3 (MMP-13) [55540] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [55541] (45 PDB entries) |
Domain d2ozrd_: 2ozr D: [149122] automated match to d1euba_ complexed with ca, gg1, hae, zn |
PDB Entry: 2ozr (more details), 2.3 Å
SCOPe Domain Sequences for d2ozrd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ozrd_ d.92.1.11 (D:) Collagenase-3 (MMP-13) {Human (Homo sapiens) [TaxId: 9606]} nvfprtlkwskmnltyrivnytpdmthsevekafkkafkvwsdvtplnftrlhdgiadim isfgikehgdfypfdgpsgllahafppgpnyggdahfdddetwtssskgynlflvaahef ghslgldhskdpgalmfpiytytgkshfmlpdddvqgiqslygpgd
Timeline for d2ozrd_: