Lineage for d2oyta2 (2oyt A:85-304)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855023Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2855066Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries)
  8. 2855078Domain d2oyta2: 2oyt A:85-304 [149079]
    Other proteins in same PDB: d2oyta3
    automated match to d1akza_
    protein/DNA complex

Details for d2oyta2

PDB Entry: 2oyt (more details), 2 Å

PDB Description: crystal structure of ung2/dna(tm)
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2oyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oyta2 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2oyta2:

Click to download the PDB-style file with coordinates for d2oyta2.
(The format of our PDB-style files is described here.)

Timeline for d2oyta2: