Lineage for d2oxma_ (2oxm A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837328Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1837329Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1837330Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1837331Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1837374Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)
  8. 1837388Domain d2oxma_: 2oxm A: [149059]
    automated match to d1akza_
    protein/DNA complex

Details for d2oxma_

PDB Entry: 2oxm (more details), 2.5 Å

PDB Description: crystal structure of a ung2/modified dna complex that represent a stabilized short-lived extrahelical state in ezymatic dna base flipping
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2oxma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxma_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2oxma_:

Click to download the PDB-style file with coordinates for d2oxma_.
(The format of our PDB-style files is described here.)

Timeline for d2oxma_: