Lineage for d2oxma2 (2oxm A:85-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101208Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2101209Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2101252Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)
  8. 2101266Domain d2oxma2: 2oxm A:85-304 [149059]
    Other proteins in same PDB: d2oxma3
    automated match to d1akza_
    protein/DNA complex

Details for d2oxma2

PDB Entry: 2oxm (more details), 2.5 Å

PDB Description: Crystal structure of a UNG2/modified DNA complex that represent a stabilized short-lived extrahelical state in ezymatic DNA base flipping
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2oxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxma2 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2oxma2:

Click to download the PDB-style file with coordinates for d2oxma2.
(The format of our PDB-style files is described here.)

Timeline for d2oxma2: