SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2oxma2 (2oxm A:85-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101208Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2101209Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2101252Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)
  8. 2101266Domain d2oxma2: 2oxm A:85-304 [149059]
    Other proteins in same PDB: d2oxma3
    automated match to d1akza_
    protein/DNA complex

Details for d2oxma2

PDB Entry: 2oxm (more details), 2.5 Å

PDB Description: Crystal structure of a UNG2/modified DNA complex that represent a stabilized short-lived extrahelical state in ezymatic DNA base flipping
PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d2oxma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxma2 c.18.1.1 (A:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2oxma2:

Click to download the PDB-style file with coordinates for d2oxma2.
(The format of our PDB-style files is described here.)

Timeline for d2oxma2: