Class b: All beta proteins [48724] (180 folds) |
Fold b.172: YopX-like [159005] (1 superfamily) consists of two domains: the N-terminal dimerisation domain of variable structure and the C-terminal domain with similarity to the SH3-like fold |
Superfamily b.172.1: YopX-like [159006] (2 families) conmrises proteins of plasmid and phage origins |
Family b.172.1.1: YopX-like [159007] (3 proteins) Pfam PF09643 |
Protein Hypothetical protein EF1440 [159008] (1 species) |
Species Enterococcus faecalis [TaxId:1351] [159009] (1 PDB entry) Uniprot Q835D7 1-143 |
Domain d2ox7b2: 2ox7 B:4-145 [149055] Other proteins in same PDB: d2ox7a2, d2ox7b3, d2ox7c3, d2ox7d3 automated match to d2ox7a1 |
PDB Entry: 2ox7 (more details), 1.78 Å
SCOPe Domain Sequences for d2ox7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox7b2 b.172.1.1 (B:4-145) Hypothetical protein EF1440 {Enterococcus faecalis [TaxId: 1351]} ipkfrawdtyekemlenvtplfddsnsmiaiitdfqikgspgtseieigsydttfnwdef pyvimqstglkdkngveifegdilvydapkkyahrrsmheiayadgrffwefldlvfcqs nilyrdgylvignihenpelle
Timeline for d2ox7b2: