SCOPe 2.08: Domain d2osda1: 2osd A:5-156

Lineage for d2osda1 (2osd A:5-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily)
   an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity

4. Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families)

5. Family d.278.1.3: MJ1460-like [160689] (1 protein)
   C-terminal part corresponds to Pfam PF02830; V4R (vinyl 4 reductase) domain

6. Protein Hypothetical protein MJ1460 [160690] (1 species)

7. Species Methanococcus jannaschii [TaxId:2190] [160691] (2 PDB entries)
   Uniprot Q58855 5-156

8. Domain d2osda1: 2osd A:5-156 [149003]
   complexed with ca, cl, edo, zn

Details for d2osda1

PDB Entry: 2osd, 2.3 Å

PDB Description: crystal structure of a vinyl-4-reductase family protein (mj_1460) from methanocaldococcus jannaschii dsm at 2.40 a resolution

PDB Compounds: (A:) Hypothetical protein MJ1460

SCOPe Domain Sequences for d2osda1:

Sequence, based on SEQRES records:

>d2osda1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]}
ekifpdileairneeiikeskkipmpyfglfalvifdkvkelgsetslyeigeefgkmls
pknieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagila
gcleeifyyyfvvnevecvsqgkdkcvfevke

Sequence, based on observed residues (ATOM records):

>d2osda1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]}
ekifpdileairneeiikeskkipmpyfglfalvifdkvkgsetslyeigeefgkmlspk
nieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagilagc
leeifyyyfvvnevecvsqgkdkcvfevke

Timeline for d2osda1:

• d2osda1 first appeared in SCOP 1.75
  
• d2osda1 appears in SCOPe 2.07