![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.278: Ligand-binding domain in the NO signalling and Golgi transport [111125] (1 superfamily) an N-terminal helical bundle and the C-terminal alpha-beta(2)-alpha-beta(2) subdomain enclose a ligand-binding cavity |
![]() | Superfamily d.278.1: Ligand-binding domain in the NO signalling and Golgi transport [111126] (4 families) ![]() |
![]() | Family d.278.1.3: MJ1460-like [160689] (1 protein) C-terminal part corresponds to Pfam PF02830; V4R (vinyl 4 reductase) domain |
![]() | Protein Hypothetical protein MJ1460 [160690] (1 species) |
![]() | Species Methanococcus jannaschii [TaxId:2190] [160691] (2 PDB entries) Uniprot Q58855 5-156 |
![]() | Domain d2osda1: 2osd A:5-156 [149003] complexed with ca, cl, edo, zn |
PDB Entry: 2osd (more details), 2.3 Å
SCOPe Domain Sequences for d2osda1:
Sequence, based on SEQRES records: (download)
>d2osda1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]} ekifpdileairneeiikeskkipmpyfglfalvifdkvkelgsetslyeigeefgkmls pknieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagila gcleeifyyyfvvnevecvsqgkdkcvfevke
>d2osda1 d.278.1.3 (A:5-156) Hypothetical protein MJ1460 {Methanococcus jannaschii [TaxId: 2190]} ekifpdileairneeiikeskkipmpyfglfalvifdkvkgsetslyeigeefgkmlspk nieelkkifklmnfgdleidenkillknppykiklsnppyqwvskeepihdfiagilagc leeifyyyfvvnevecvsqgkdkcvfevke
Timeline for d2osda1: