SCOP 1.75: Domain d2ooya1: 2ooy A:449-575

Lineage for d2ooya1 (2ooy A:449-575)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.6: KA1-like [103243] (2 families)
   contains a single copy of this fold

5. Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (3 proteins)
   PfamB PB166430

6. Protein Snf1-like protein kinase ssp2 [160726] (1 species)

7. Species Schizosaccharomyces pombe [TaxId:4896] [160727] (6 PDB entries)
   Uniprot O74536 449-576

8. Domain d2ooya1: 2ooy A:449-575 [148946]
   Other proteins in same PDB: d2ooyb1, d2ooyd1
   automatically matched to 2OOX A:449-576
   complexed with atp, flc

Details for d2ooya1

PDB Entry: 2ooy, 2.88 Å

PDB Description: Crystal structure of the adenylate sensor from AMP-activated protein kinase complexed with ATP

PDB Compounds: (A:) SNF1-like protein kinase ssp2

SCOP Domain Sequences for d2ooya1:

Sequence; same for both SEQRES and ATOM records:

>d2ooya1 d.129.6.2 (A:449-575) Snf1-like protein kinase ssp2 {Schizosaccharomyces pombe [TaxId: 4896]}
rnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphckr
egkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlcam
lvcklfs

Timeline for d2ooya1:

• d2ooya1 is new in SCOP 1.75
  
• d2ooya1 is called d2ooya_ in SCOPe 2.01
  
• d2ooya1 appears in the current release, SCOPe 2.08, called d2ooya_