Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.6: KA1-like [103243] (3 families) contains a single copy of this fold |
Family d.129.6.2: Ssp2 C-terminal domain-like [160723] (4 proteins) PfamB PB166430 |
Protein Snf1-like protein kinase ssp2 [160726] (1 species) |
Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [160727] (6 PDB entries) Uniprot O74536 449-576 |
Domain d2ooxc_: 2oox C: [148942] Other proteins in same PDB: d2ooxb1, d2ooxd_, d2ooxe1, d2ooxe2 automated match to d2ooxa1 complexed with amp |
PDB Entry: 2oox (more details), 2.6 Å
SCOPe Domain Sequences for d2ooxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ooxc_ d.129.6.2 (C:) Snf1-like protein kinase ssp2 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} rrnkwhfgvrcrgdapeillavyralqragaqftvpkpvngkyrsdmytiksrweiphck regkntyayielqlyevmpgcfmldvksngykdiyshpertadhgmddlkssfpfldlca mlvcklfs
Timeline for d2ooxc_: