Lineage for d2oopa1 (2oop A:1-36)

  1. Root: SCOPe 2.04
  2. 1713148Class j: Peptides [58231] (126 folds)
  3. 1713367Fold j.6: Peptide hormones [58283] (1 superfamily)
    contains one alpha-helix
  4. 1713368Superfamily j.6.1: Peptide hormones [58284] (1 family) (S)
    this is not a true superfamily
  5. 1713369Family j.6.1.1: Peptide hormones [58285] (19 proteins)
  6. 1713449Protein Peptide YY, PYY [58292] (2 species)
  7. 1713453Species Pig (Sus scrofa) [TaxId:9823] [58293] (6 PDB entries)
    Uniprot P68005
  8. 1713455Domain d2oopa1: 2oop A:1-36 [148937]
    automatically matched to d1qbfa_

Details for d2oopa1

PDB Entry: 2oop (more details)

PDB Description: structure of tyr7-pyy in solution
PDB Compounds: (A:) Peptide YY

SCOPe Domain Sequences for d2oopa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oopa1 j.6.1.1 (A:1-36) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]}
ypakpeypgedaspeelsryyaslrhylnlvtrqry

SCOPe Domain Coordinates for d2oopa1:

Click to download the PDB-style file with coordinates for d2oopa1.
(The format of our PDB-style files is described here.)

Timeline for d2oopa1: