Class a: All alpha proteins [46456] (290 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.11: AF1782-like [158372] (1 family) automatically mapped to Pfam PF04010 |
Family a.8.11.1: AF1782-like [158373] (3 proteins) Pfam PF04010; DUF357 |
Protein Hypothetical protein AF1782 [158374] (1 species) |
Species Archaeoglobus fulgidus [TaxId:2234] [158375] (1 PDB entry) Uniprot O28492 1-75 |
Domain d2oo2a1: 2oo2 A:2-75 [148917] Other proteins in same PDB: d2oo2a2 |
PDB Entry: 2oo2 (more details), 1.8 Å
SCOPe Domain Sequences for d2oo2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oo2a1 a.8.11.1 (A:2-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]} eeelrretlkwlerieervkeiegdegfmrnieayisdsryflekgdlvrafecvvwawa wleiglevgklhet
Timeline for d2oo2a1: