Lineage for d2oo2a1 (2oo2 A:2-75)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697332Superfamily a.8.11: AF1782-like [158372] (1 family) (S)
    automatically mapped to Pfam PF04010
  5. 2697333Family a.8.11.1: AF1782-like [158373] (3 proteins)
    Pfam PF04010; DUF357
  6. 2697334Protein Hypothetical protein AF1782 [158374] (1 species)
  7. 2697335Species Archaeoglobus fulgidus [TaxId:2234] [158375] (1 PDB entry)
    Uniprot O28492 1-75
  8. 2697336Domain d2oo2a1: 2oo2 A:2-75 [148917]
    Other proteins in same PDB: d2oo2a2

Details for d2oo2a1

PDB Entry: 2oo2 (more details), 1.8 Å

PDB Description: crystal structure of protein af1782 from archaeoglobus fulgidus, pfam duf357
PDB Compounds: (A:) Hypothetical protein AF_1782

SCOPe Domain Sequences for d2oo2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oo2a1 a.8.11.1 (A:2-75) Hypothetical protein AF1782 {Archaeoglobus fulgidus [TaxId: 2234]}
eeelrretlkwlerieervkeiegdegfmrnieayisdsryflekgdlvrafecvvwawa
wleiglevgklhet

SCOPe Domain Coordinates for d2oo2a1:

Click to download the PDB-style file with coordinates for d2oo2a1.
(The format of our PDB-style files is described here.)

Timeline for d2oo2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2oo2a2