Lineage for d2onki1 (2onk I:1-252)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2256584Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2256585Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2256586Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2256610Protein Molybdate/tungstate transport system permease protein WtpB (ModB) [161102] (1 species)
  7. 2256611Species Archaeoglobus fulgidus [TaxId:2234] [161103] (1 PDB entry)
    Uniprot O30143 1-252
  8. 2256615Domain d2onki1: 2onk I:1-252 [148911]
    Other proteins in same PDB: d2onka1, d2onkb_, d2onke1, d2onkf_, d2onkg_, d2onkj2, d2onkj3
    automatically matched to 2ONK C:1-252
    complexed with mg, po4, wo4

Details for d2onki1

PDB Entry: 2onk (more details), 3.1 Å

PDB Description: ABC transporter ModBC in complex with its binding protein ModA
PDB Compounds: (I:) Molybdate/tungstate ABC transporter, permease protein

SCOPe Domain Sequences for d2onki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2onki1 f.58.1.1 (I:1-252) Molybdate/tungstate transport system permease protein WtpB (ModB) {Archaeoglobus fulgidus [TaxId: 2234]}
mrllfsallallssiillfvllpvaatvtlqlfnfdeflkaasdpavwkvvlttyyaali
stliavifgtplayilarksfpgksvvegivdlpvviphtvagiallvvfgssgligsfs
plkfvdalpgivvamlfvsvpiyinqakegfasvdvrlehvartlgssplrvfftvslpl
svrhivagaimswargisefgavvviayypmiaptliyerylseglsaampvaailills
lavfvalriivg

SCOPe Domain Coordinates for d2onki1:

Click to download the PDB-style file with coordinates for d2onki1.
(The format of our PDB-style files is described here.)

Timeline for d2onki1: