Lineage for d2olvb1 (2olv B:67-292)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533651Family d.2.1.10: PBP transglycosylase domain-like [159832] (3 proteins)
    Pfam PF00912; lacking the characteristic beta-sheet; otherwise has a similar fold to the Family 19 glycosidase
  6. 2533656Protein Penicillin-binding protein 2, PBP2 [159835] (1 species)
  7. 2533657Species Staphylococcus aureus [TaxId:1280] [159836] (3 PDB entries)
    Uniprot Q2YY56 67-292
  8. 2533660Domain d2olvb1: 2olv B:67-292 [148823]
    Other proteins in same PDB: d2olva2, d2olvb2
    automated match to d2olva1
    complexed with m0e

Details for d2olvb1

PDB Entry: 2olv (more details), 2.8 Å

PDB Description: Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex
PDB Compounds: (B:) Penicillin-binding protein 2

SCOPe Domain Sequences for d2olvb1:

Sequence, based on SEQRES records: (download)

>d2olvb1 d.2.1.10 (B:67-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
aklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldy
krlfgaigknltggfgsegastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskdd
ifqvylnkiyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaa
edrkntvlylmhyhkritdkqwedakkidlkanlvnrtpeerqnid

Sequence, based on observed residues (ATOM records): (download)

>d2olvb1 d.2.1.10 (B:67-292) Penicillin-binding protein 2, PBP2 {Staphylococcus aureus [TaxId: 1280]}
aklqdpipakiydkngelvktldngqrhehvnlkdvpksmkdavlatednrfyehgaldy
krlfgaigkngastltqqvvkdaflsqhksigrkaqeaylsyrleqeyskddifqvylnk
iyysdgvtgikaaakyyfnkdlkdlnlaeeaylaglpqvpnnyniydhpkaaedrkntvl
ylmhyhkritdkqwedakkidlkanlvnrtpeerqnid

SCOPe Domain Coordinates for d2olvb1:

Click to download the PDB-style file with coordinates for d2olvb1.
(The format of our PDB-style files is described here.)

Timeline for d2olvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2olvb2