Lineage for d2okca1 (2okc A:9-433)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130341Family c.66.1.45: N-6 DNA Methylase-like [142606] (3 protein domains)
    Pfam PF02384; contains C-terminal extension to the canonical fold and extra N-terminal all-alpha domain similar to the insert domain of the DAM family (88788)
  6. 2130349Protein Type I restriction enzyme StySJI M protein [159684] (1 species)
  7. 2130350Species Bacteroides thetaiotaomicron [TaxId:818] [159685] (1 PDB entry)
    Uniprot Q89Z59 9-433
  8. 2130351Domain d2okca1: 2okc A:9-433 [148801]
    complexed with cl, gol, ipa, sam

Details for d2okca1

PDB Entry: 2okc (more details), 2.2 Å

PDB Description: crystal structure of type i restriction enzyme stysji m protein (np_813429.1) from bacteroides thetaiotaomicron vpi-5482 at 2.20 a resolution
PDB Compounds: (A:) Type I restriction enzyme StySJI M protein

SCOPe Domain Sequences for d2okca1:

Sequence, based on SEQRES records: (download)

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}
qsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwadli
afdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimdgd
vkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfllta
ydymkgqsaskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedsleke
pstlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvlpd
nvlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfydyr
tdikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktsldit
wikpg

Sequence, based on observed residues (ATOM records): (download)

>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]}
qsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwadli
afdgldlvkqyeetlkllseldnligtiytkaqnkidkpvylkkvitmideeqwlimdgd
vkgaiyesilekngqdkksgagqyftprpliqamvdcinpqmgetvcdpacgtggfllta
ydymkgqsskekrdflrdkalhgvdntplvvtlasmnlylhgigtdrspivcedslekep
stlvdvilanppfgtrpagsvdinrpdfyvetknnqlnflqhmmlmlktggraavvlpdn
vlfeagagetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfydyrt
dikhtlatnklerhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktslditw
ikpg

SCOPe Domain Coordinates for d2okca1:

Click to download the PDB-style file with coordinates for d2okca1.
(The format of our PDB-style files is described here.)

Timeline for d2okca1: