SCOPe 2.07: Domain d2oiwb_: 2oiw B:

Lineage for d2oiwb_ (2oiw B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.1: 4HBT-like [54638] (19 proteins)
   Pfam PF03061

6. Protein GK1870 orthologue [160182] (1 species)
   Predicted 4-hydroxybenzoyl-CoA thioesterase

7. Species Bacillus stearothermophilus [TaxId:1422] [160183] (1 PDB entry)
   Uniprot Q5KYT1 1-131

8. Domain d2oiwb_: 2oiw B: [148795]
   automated match to d2oiwa1
   complexed with edo, mg

Details for d2oiwb_

PDB Entry: 2oiw, 2 Å

PDB Description: The structure of a predicted thioesterase from Bacillus stearothermophilus

PDB Compounds: (B:) putative 4-hydroxybenzoyl-CoA thioesterase

SCOPe Domain Sequences for d2oiwb_:

Sequence; same for both SEQRES and ATOM records:

>d2oiwb_ d.38.1.1 (B:) GK1870 orthologue {Bacillus stearothermophilus [TaxId: 1422]}
namfttvitprvsetdgvghinnttvpvwfeagrheifklftpdlsfkrwrmviirmevd
yvnqmyygqdvtvytgierigntsltiyeeihqngvvcakgrsvyvnfnfdtgrpepipd
dirvklrehvwqp

Timeline for d2oiwb_:

• d2oiwb_ first appeared in SCOP 1.75, called d2oiwb1
  
• d2oiwb_ appears in SCOPe 2.06
  
• d2oiwb_ appears in the current release, SCOPe 2.08