SCOPe 2.08: Domain d2oh3a1: 2oh3 A:3-154

Lineage for d2oh3a1 (2oh3 A:3-154)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.8: AMB4284-like [158408] (1 protein)
   possible rubrerythrin
   automatically mapped to Pfam PF02915

6. Protein Uncharacterized protein AMB4284 homologue [158409] (1 species)

7. Species Magnetospirillum magnetotacticum ms-1 [TaxId:272627] [158410] (1 PDB entry)
   Uniprot Q2VZ87 3-154

8. Domain d2oh3a1: 2oh3 A:3-154 [148774]
   complexed with imd, pge, zn

Details for d2oh3a1

PDB Entry: 2oh3, 2 Å

PDB Description: crystal structure of cog1633: uncharacterized conserved protein (zp_00055496.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution

PDB Compounds: (A:) COG1633: Uncharacterized conserved protein

SCOPe Domain Sequences for d2oh3a1:

Sequence, based on SEQRES records:

>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]}
ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra
lelpklmswqyrwktppevgdendihylmtpyhalryardneirgmeyykeaaansadpe
vkrlgadfaaeeaehvvaldkwiektprpsit

Sequence, based on observed residues (ATOM records):

>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]}
ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra
lelpklmswqyrwktppevgdehylmtpyhalryardneirgmeyykeaaansadpevkr
lgadfaaeeaehvvaldkwiektprpsit

Timeline for d2oh3a1:

• d2oh3a1 first appeared in SCOP 1.75
  
• d2oh3a1 appears in SCOPe 2.07