Lineage for d2oh3a1 (2oh3 A:3-154)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990528Family a.25.1.8: AMB4284-like [158408] (1 protein)
    possible rubrerythrin
    automatically mapped to Pfam PF02915
  6. 1990529Protein Uncharacterized protein AMB4284 homologue [158409] (1 species)
  7. 1990530Species Magnetospirillum magnetotacticum ms-1 [TaxId:272627] [158410] (1 PDB entry)
    Uniprot Q2VZ87 3-154
  8. 1990531Domain d2oh3a1: 2oh3 A:3-154 [148774]
    complexed with imd, pge, zn

Details for d2oh3a1

PDB Entry: 2oh3 (more details), 2 Å

PDB Description: crystal structure of cog1633: uncharacterized conserved protein (zp_00055496.1) from magnetospirillum magnetotacticum ms-1 at 2.00 a resolution
PDB Compounds: (A:) COG1633: Uncharacterized conserved protein

SCOPe Domain Sequences for d2oh3a1:

Sequence, based on SEQRES records: (download)

>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]}
ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra
lelpklmswqyrwktppevgdendihylmtpyhalryardneirgmeyykeaaansadpe
vkrlgadfaaeeaehvvaldkwiektprpsit

Sequence, based on observed residues (ATOM records): (download)

>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]}
ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra
lelpklmswqyrwktppevgdehylmtpyhalryardneirgmeyykeaaansadpevkr
lgadfaaeeaehvvaldkwiektprpsit

SCOPe Domain Coordinates for d2oh3a1:

Click to download the PDB-style file with coordinates for d2oh3a1.
(The format of our PDB-style files is described here.)

Timeline for d2oh3a1: