Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.8: AMB4284-like [158408] (1 protein) possible rubrerythrin automatically mapped to Pfam PF02915 |
Protein Uncharacterized protein AMB4284 homologue [158409] (1 species) |
Species Magnetospirillum magnetotacticum ms-1 [TaxId:272627] [158410] (1 PDB entry) Uniprot Q2VZ87 3-154 |
Domain d2oh3a1: 2oh3 A:3-154 [148774] complexed with imd, pge, zn |
PDB Entry: 2oh3 (more details), 2 Å
SCOPe Domain Sequences for d2oh3a1:
Sequence, based on SEQRES records: (download)
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra lelpklmswqyrwktppevgdendihylmtpyhalryardneirgmeyykeaaansadpe vkrlgadfaaeeaehvvaldkwiektprpsit
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} ytlaeflahaialeteaaeryveladmmeahnnldtatvfrdmarfstlhgdeikqrsra lelpklmswqyrwktppevgdehylmtpyhalryardneirgmeyykeaaansadpevkr lgadfaaeeaehvvaldkwiektprpsit
Timeline for d2oh3a1: