SCOPe 2.01: Domain d2od6b1: 2od6 B:2-109

Lineage for d2od6b1 (2od6 B:2-109)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.22: Marine metagenome family DABB1 [160301] (2 proteins)

6. Protein Hypothetical protein GOS_2359375 [160304] (1 species)

7. Species Environmental samples [TaxId:33858] [160305] (1 PDB entry)
   marine metagenome

8. Domain d2od6b1: 2od6 B:2-109 [148738]
   automatically matched to 2OD6 A:1-109
   complexed with edo, oha

Details for d2od6b1

PDB Entry: 2od6, 1.85 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein (jcvi_pep_1096682647733) from uncultured marine organism at 1.85 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2od6b1:

Sequence; same for both SEQRES and ATOM records:

>d2od6b1 d.58.4.22 (B:2-109) Hypothetical protein GOS_2359375 {Environmental samples}
aepkftsfttadfindvdmelfidavektapvwvkemksrgllkfsmnrvwnkgevfrvv
mtyeykdrasfeaniayledtfgknpvflqlvttakfttsrclvvmev

Timeline for d2od6b1:

• d2od6b1 first appeared in SCOP 1.75
  
• d2od6b1 appears in SCOPe 2.02
  
• d2od6b1 appears in the current release, SCOPe 2.08