SCOP 1.75: Domain d2oand2: 2oan D:147-371

Lineage for d2oand2 (2oan D:147-371)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)

6. Protein Actin [53073] (6 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)

8. Domain d2oand2: 2oan D:147-371 [148713]
   automatically matched to d1hlua2
   complexed with atp, ca, oc4, so4

Details for d2oand2

PDB Entry: 2oan, 2.61 Å

PDB Description: structure of oxidized beta-actin

PDB Compounds: (D:) Actin, cytoplasmic 1

SCOP Domain Sequences for d2oand2:

Sequence; same for both SEQRES and ATOM records:

>d2oand2 c.55.1.1 (D:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivh

Timeline for d2oand2:

• d2oand2 is new in SCOP 1.75
  
• d2oand2 appears in SCOPe 2.01
  
• d2oand2 appears in the current release, SCOPe 2.08