SCOPe 2.08: Domain d2oand2: 2oan D:147-375

Lineage for d2oand2 (2oan D:147-375)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [225259] (3 PDB entries)

8. Domain d2oand2: 2oan D:147-375 [148713]
   Other proteins in same PDB: d2oana1, d2oanb1, d2oanc1, d2oand1
   automated match to d1d4xa2
   complexed with atp, ca, so4

Details for d2oand2

PDB Entry: 2oan, 2.61 Å

PDB Description: structure of oxidized beta-actin

PDB Compounds: (D:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d2oand2:

Sequence; same for both SEQRES and ATOM records:

>d2oand2 c.55.1.1 (D:147-375) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rttgivmdsgdgvthtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmescgihettfnsimkcdvdirkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkcf

Timeline for d2oand2:

• d2oand2 first appeared in SCOP 1.75
  
• d2oand2 appears in SCOPe 2.07