![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (52 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [226802] (3 PDB entries) |
![]() | Domain d2oanb1: 2oan B:4-146 [148708] Other proteins in same PDB: d2oana2, d2oanb2, d2oanc2, d2oand2 automated match to d1d4xa1 complexed with atp, ca, so4 |
PDB Entry: 2oan (more details), 2.61 Å
SCOPe Domain Sequences for d2oanb1:
Sequence, based on SEQRES records: (download)
>d2oanb1 c.55.1.0 (B:4-146) automated matches {Cow (Bos taurus) [TaxId: 9913]} diaalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg iltlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqim fetfntpamyvaiqavlslyasg
>d2oanb1 c.55.1.0 (B:4-146) automated matches {Cow (Bos taurus) [TaxId: 9913]} diaalvvdngsgmckagfagddapravfpsivgrprkdsyvgdeaqskrgiltlkypieh givtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpamy vaiqavlslyasg
Timeline for d2oanb1: