Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) |
Family d.38.1.1: 4HBT-like [54638] (18 proteins) Pfam PF03061 |
Protein Hypothetical protein Jann0674 [160180] (1 species) |
Species Jannaschia sp. ccs1 [TaxId:290400] [160181] (1 PDB entry) Uniprot Q28UM1 1-143 |
Domain d2oafa1: 2oaf A:1-143 [148695] complexed with cit, cl, pge, po4 |
PDB Entry: 2oaf (more details), 2 Å
SCOP Domain Sequences for d2oafa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]} mqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldtn vgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvfti adqfksqpapdhlraliephipa
Timeline for d2oafa1: