SCOP 1.75: Domain d2oafa1: 2oaf A:1-143

Lineage for d2oafa1 (2oaf A:1-143)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)

5. Family d.38.1.1: 4HBT-like [54638] (18 proteins)
   Pfam PF03061

6. Protein Hypothetical protein Jann0674 [160180] (1 species)

7. Species Jannaschia sp. ccs1 [TaxId:290400] [160181] (1 PDB entry)
   Uniprot Q28UM1 1-143

8. Domain d2oafa1: 2oaf A:1-143 [148695]
   complexed with cit, cl, pge, po4

Details for d2oafa1

PDB Entry: 2oaf, 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_508616.1) from jannaschia sp. ccs1 at 2.00 a resolution

PDB Compounds: (A:) Thioesterase superfamily

SCOP Domain Sequences for d2oafa1:

Sequence; same for both SEQRES and ATOM records:

>d2oafa1 d.38.1.1 (A:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]}
mqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldtn
vgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvfti
adqfksqpapdhlraliephipa

Timeline for d2oafa1:

• d2oafa1 is new in SCOP 1.75
  
• d2oafa1 appears in SCOPe 2.01
  
• d2oafa1 appears in the current release, SCOPe 2.08