Lineage for d2oafb1 (2oaf B:1-143)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858618Family d.38.1.1: 4HBT-like [54638] (18 proteins)
    Pfam PF03061
  6. 858641Protein Hypothetical protein Jann0674 [160180] (1 species)
  7. 858642Species Jannaschia sp. ccs1 [TaxId:290400] [160181] (1 PDB entry)
    Uniprot Q28UM1 1-143
  8. 858644Domain d2oafb1: 2oaf B:1-143 [148696]
    automatically matched to 2OAF A:1-143
    complexed with cit, cl, pge, po4

Details for d2oafb1

PDB Entry: 2oaf (more details), 2 Å

PDB Description: crystal structure of thioesterase superfamily (yp_508616.1) from jannaschia sp. ccs1 at 2.00 a resolution
PDB Compounds: (B:) Thioesterase superfamily

SCOP Domain Sequences for d2oafb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oafb1 d.38.1.1 (B:1-143) Hypothetical protein Jann0674 {Jannaschia sp. ccs1 [TaxId: 290400]}
mqprpdsafvhdvrvtwgdcdpakiaytghlprfaleaidawwseyhgpggwyhleldtn
vgtpfvrlemdfkspvtprhilkchtwptrlgtksitfrvdgvqdgvtcfvgaftcvfti
adqfksqpapdhlraliephipa

SCOP Domain Coordinates for d2oafb1:

Click to download the PDB-style file with coordinates for d2oafb1.
(The format of our PDB-style files is described here.)

Timeline for d2oafb1: