SCOPe 2.07: Domain d2o9qa_: 2o9q A:

Lineage for d2o9qa_ (2o9q A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
   Uniprot P00760

8. Domain d2o9qa_: 2o9q A: [148688]
   automated match to d1aq7a_
   complexed with ca, so4

Details for d2o9qa_

PDB Entry: 2o9q, 1.7 Å

PDB Description: the crystal structure of bovine trypsin complexed with a small inhibition peptide orb2k

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d2o9qa_:

Sequence; same for both SEQRES and ATOM records:

>d2o9qa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2o9qa_:

• d2o9qa_ first appeared in SCOP 1.75, called d2o9qa1
  
• d2o9qa_ appears in SCOPe 2.06
  
• d2o9qa_ appears in the current release, SCOPe 2.08