SCOPe 2.07: Domain d2o73a_: 2o73 A:

Lineage for d2o73a_ (2o73 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.288: UraD-like [158693] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.288.1: UraD-Like [158694] (1 family)
   automatically mapped to Pfam PF09349

5. Family a.288.1.1: UraD-like [158695] (2 proteins)
   Pfam PF09349; OHCU decarboxylase (formerly DUF1991)

6. Protein OHCU decarboxylase, UraD [158696] (2 species)
   2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase

7. Species Zebrafish (Danio rerio) [TaxId:7955] [158698] (3 PDB entries)
   Uniprot A1L259 2-166

8. Domain d2o73a_: 2o73 A: [148651]
   automated match to d2o70a1
   complexed with 2al

Details for d2o73a_

PDB Entry: 2o73, 1.8 Å

PDB Description: Structure of OHCU decarboxylase in complex with allantoin

PDB Compounds: (A:) OHCU decarboxylase

SCOPe Domain Sequences for d2o73a_:

Sequence; same for both SEQRES and ATOM records:

>d2o73a_ a.288.1.1 (A:) OHCU decarboxylase, UraD {Zebrafish (Danio rerio) [TaxId: 7955]}
dinvvnalayedfvklfgnvvekcplisaaiwsyrpfkdladiearisefihslpdsgke
gilrchpdlagrdlqsgtltpesqeeqsqagmttldsaeivhmyrlnseykerfgfpfvi
carlnnkadivrqlserlknrrtaelecaieevkkicslrlhsiv

Timeline for d2o73a_:

• d2o73a_ first appeared in SCOP 1.75, called d2o73a1
  
• d2o73a_ appears in SCOPe 2.06
  
• d2o73a_ appears in the current release, SCOPe 2.08