Lineage for d2o6tg_ (2o6t G:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550606Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2550673Protein Hypothetical thioesterase PA5185 [143158] (1 species)
  7. 2550674Species Pseudomonas aeruginosa [TaxId:287] [143159] (5 PDB entries)
    Uniprot Q9HU04 5-146
  8. 2550682Domain d2o6tg_: 2o6t G: [148640]
    Other proteins in same PDB: d2o6ta3, d2o6ti3
    automated match to d2av9a1
    complexed with cl

Details for d2o6tg_

PDB Entry: 2o6t (more details), 2.55 Å

PDB Description: crystal structure of the pa5185 protein from pseudomonas aeruginosa strain pao1- orthorhombic form (p2221).
PDB Compounds: (G:) thioesterase

SCOPe Domain Sequences for d2o6tg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2o6tg_ d.38.1.1 (G:) Hypothetical thioesterase PA5185 {Pseudomonas aeruginosa [TaxId: 287]}
aprplreqylhfqpistrwhdndiyghvnnvtyyaffdtavntylierggldiqggevig
lvvssscdyfapvafpqriemglrvarlgnssvqyelalflegqreacaagrfvhvfver
rssrpvaipqelrdalaalqss

SCOPe Domain Coordinates for d2o6tg_:

Click to download the PDB-style file with coordinates for d2o6tg_.
(The format of our PDB-style files is described here.)

Timeline for d2o6tg_: