SCOPe 2.08: Domain d2o5fb_: 2o5f B:

Lineage for d2o5fb_ (2o5f B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)

6. Protein Hypothetical protein DR0079 [103217] (2 species)

7. Species Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId:243230] [160692] (1 PDB entry)

8. Domain d2o5fb_: 2o5f B: [148597]
   automated match to d1q27a_

Details for d2o5fb_

PDB Entry: 2o5f, 1.9 Å

PDB Description: Crystal Structure of DR0079 from Deinococcus radiodurans at 1.9 Angstrom Resolution

PDB Compounds: (B:) Putative Nudix hydrolase DR_0079

SCOPe Domain Sequences for d2o5fb_:

Sequence; same for both SEQRES and ATOM records:

>d2o5fb_ d.113.1.2 (B:) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]}
erldlvnerdevvgqilrtdpalrwervrvvnaflrnsqgqlwiprrspskslfpnaldv
svggavqsgetyeeafrreareelnveidalswrplasfspfqttlssfmcvyelrsdat
pifnpndisggewltpehllariaageaakgdlaelvrrcyr

Timeline for d2o5fb_:

• d2o5fb_ first appeared in SCOP 1.75, called d2o5fb1
  
• d2o5fb_ appears in SCOPe 2.07