Lineage for d1q27a_ (1q27 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971664Family d.113.1.2: IPP isomerase-like [64369] (4 proteins)
  6. 2971665Protein Hypothetical protein DR0079 [103217] (2 species)
  7. 2971669Species Deinococcus radiodurans [TaxId:1299] [103218] (1 PDB entry)
  8. 2971670Domain d1q27a_: 1q27 A: [95621]
    structural genomics

Details for d1q27a_

PDB Entry: 1q27 (more details)

PDB Description: nmr solution structure of dr0079: an hypothetical nudix protein from d. radiodurans
PDB Compounds: (A:) Putative Nudix hydrolase DR0079

SCOPe Domain Sequences for d1q27a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q27a_ d.113.1.2 (A:) Hypothetical protein DR0079 {Deinococcus radiodurans [TaxId: 1299]}
mggvsderldlvnerdevvgqilrtdpalrwervrvvnaflrnsqgqlwiprrspskslf
pnaldvsvggavqsgetyeeafrreareelnveidalswrplasfspfqttlssfmcvye
lrsdatpifnpndisggewltpehllariaageaakgdlaelvrrcyreee

SCOPe Domain Coordinates for d1q27a_:

Click to download the PDB-style file with coordinates for d1q27a_.
(The format of our PDB-style files is described here.)

Timeline for d1q27a_: