PDB entry 1q27

View 1q27 on RCSB PDB site
Description: NMR Solution Structure of DR0079: An hypothetical Nudix protein from D. radiodurans
Class: hydrolase
Keywords: Nudix hydrolase, radiation resistance
Deposited on 2003-07-23, released 2003-08-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Nudix hydrolase DR0079
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene: DR0079
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1q27a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q27A (A:)
    mggvsderldlvnerdevvgqilrtdpalrwervrvvnaflrnsqgqlwiprrspskslf
    pnaldvsvggavqsgetyeeafrreareelnveidalswrplasfspfqttlssfmcvye
    lrsdatpifnpndisggewltpehllariaageaakgdlaelvrrcyreee