Lineage for d2o3ab2 (2o3a B:2-167)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2528466Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2528467Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2528669Family c.116.1.8: AF0751-like [159523] (1 protein)
    Pfam PF01994; DUF127
  6. 2528670Protein Uncharacterized protein AF0751 [159524] (1 species)
  7. 2528671Species Archaeoglobus fulgidus [TaxId:2234] [159525] (1 PDB entry)
    Uniprot O29507 1-167
  8. 2528673Domain d2o3ab2: 2o3a B:2-167 [148571]
    Other proteins in same PDB: d2o3aa2, d2o3ab3
    automated match to d2o3aa1

Details for d2o3ab2

PDB Entry: 2o3a (more details), 2.2 Å

PDB Description: crystal structure of a protein af_0751 from archaeoglobus fulgidus
PDB Compounds: (B:) UPF0106 protein AF_0751

SCOPe Domain Sequences for d2o3ab2:

Sequence, based on SEQRES records: (download)

>d2o3ab2 c.116.1.8 (B:2-167) Uncharacterized protein AF0751 {Archaeoglobus fulgidus [TaxId: 2234]}
evyvlrlghrperdkristhvaltarafgakgiyfdtedksvfesvrdvverwggdffik
avswkkllrefdglkvhltmygiplpqkleeikradkvlvvvgaekvppevyelcdlnis
igtqphsevaalavfldrvlgkvfdisfddakikvipsergkrvvs

Sequence, based on observed residues (ATOM records): (download)

>d2o3ab2 c.116.1.8 (B:2-167) Uncharacterized protein AF0751 {Archaeoglobus fulgidus [TaxId: 2234]}
evyvlrlghrperdkristhvaltarafgakgiyfdtedksvfesvrdvverwggdffik
avswkkllrefdglkvhltmygiplpqkleeikradkvlvvvgppevyelcdlnisigtq
phsevaalavfldrvlgkvfdisfddakikvipsergkrvvs

SCOPe Domain Coordinates for d2o3ab2:

Click to download the PDB-style file with coordinates for d2o3ab2.
(The format of our PDB-style files is described here.)

Timeline for d2o3ab2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2o3ab3