Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins) |
Protein Heat-labile toxin [50205] (2 species) |
Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries) |
Domain d2o2ll1: 2o2l L:1-103 [148562] automatically matched to d1ltrf_ complexed with a2g, bgc, fuc, gal |
PDB Entry: 2o2l (more details), 2.53 Å
SCOP Domain Sequences for d2o2ll1:
Sequence, based on SEQRES records: (download)
>d2o2ll1 b.40.2.1 (L:1-103) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismek
>d2o2ll1 b.40.2.1 (L:1-103) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]} apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgdsqkka iermkdtlrityltetkidklcvwnnktpnsiaaismek
Timeline for d2o2ll1: