Lineage for d2o2ld1 (2o2l D:1-103)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 798735Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 798736Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 798869Protein Heat-labile toxin [50205] (2 species)
  7. 798870Species Escherichia coli, type IB [TaxId:562] [50206] (20 PDB entries)
  8. 798966Domain d2o2ld1: 2o2l D:1-103 [148554]
    automatically matched to d1ltrf_
    complexed with a2g, bgc, fuc, gal

Details for d2o2ld1

PDB Entry: 2o2l (more details), 2.53 Å

PDB Description: crystal structure of human heat-labile enterotoxin in complex with a blood group a antigen analog
PDB Compounds: (D:) heat-labile enterotoxin b chain

SCOP Domain Sequences for d2o2ld1:

Sequence, based on SEQRES records: (download)

>d2o2ld1 b.40.2.1 (D:1-103) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismek

Sequence, based on observed residues (ATOM records): (download)

>d2o2ld1 b.40.2.1 (D:1-103) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqsitelcseyhntqiytindkilsytesmagkremviitfksgatfqvevpdsqkkai
ermkdtlrityltetkidklcvwnnktpnsiaaismek

SCOP Domain Coordinates for d2o2ld1:

Click to download the PDB-style file with coordinates for d2o2ld1.
(The format of our PDB-style files is described here.)

Timeline for d2o2ld1: