SCOPe 2.07: Domain d2o2ad2: 2o2a D:1-123

Lineage for d2o2ad2 (2o2a D:1-123)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.33: SecB-like [54610] (1 superfamily)
   beta(4)-alpha(2); two layers: alpha/beta; antiparallel sheet: order 1432

4. Superfamily d.33.1: SecB-like [54611] (3 families)

5. Family d.33.1.2: SP1558-like [160154] (2 proteins)
   Pfam PF06619; DUF1149

6. Protein Hypothetical protein gbs1413 [160157] (1 species)

7. Species Streptococcus agalactiae [TaxId:1311] [160158] (1 PDB entry)
   Uniprot Q8E4I8 1-124

8. Domain d2o2ad2: 2o2a D:1-123 [148553]
   Other proteins in same PDB: d2o2aa2, d2o2ab3, d2o2ac3, d2o2ad3
   automated match to d2o2aa1

Details for d2o2ad2

PDB Entry: 2o2a, 2.1 Å

PDB Description: The crystal structure of a protein of unknown function from Streptococcus agalactiae

PDB Compounds: (D:) Hypothetical protein gbs1413

SCOPe Domain Sequences for d2o2ad2:

Sequence; same for both SEQRES and ATOM records:

>d2o2ad2 d.33.1.2 (D:1-123) Hypothetical protein gbs1413 {Streptococcus agalactiae [TaxId: 1311]}
mevireqefvnqyhydarnleweeengtpktnfevtfqlanrdeaakvtsivavlqfviv
rdefvisgvisqmahiqgrlinepsefsqdevenlaaplleivkrltyevteialdrpgv
tle

Timeline for d2o2ad2:

• d2o2ad2 first appeared in SCOP 1.75, called d2o2ad1
  
• d2o2ad2 appears in SCOPe 2.06
  
• d2o2ad2 appears in the current release, SCOPe 2.08