SCOPe 2.01: Domain d2o14a2: 2o14 A:160-367

Lineage for d2o14a2 (2o14 A:160-367)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.8: YxiM C-terminal domain-like [159482] (1 protein)
   subfamily of Pfam PF00657

6. Protein Hypothetical protein YxiM [159483] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [159484] (1 PDB entry)
   Uniprot P42304 175-382

8. Domain d2o14a2: 2o14 A:160-367 [148545]
   Other proteins in same PDB: d2o14a1
   complexed with mn, so4

Details for d2o14a2

PDB Entry: 2o14, 2.1 Å

PDB Description: x-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595

PDB Compounds: (A:) Hypothetical protein yxiM

SCOPe Domain Sequences for d2o14a2:

Sequence; same for both SEQRES and ATOM records:

>d2o14a2 c.23.10.8 (A:160-367) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}
vtnrtiyvggdstvcnyyplnsskqagwgqmlphyidkhtfqvrnmasggqiargfrndg
qleailkyikpgdyfmlqlgindtnpkhkeseaefkevmrdmirqvkakgadvilstpqg
ratdftsegihssvnrwyrasilalaeeektylidlnvlssayftsigpertlglymdgd
tlhpnragadalarlavqelkrqgiagf

Timeline for d2o14a2:

• d2o14a2 first appeared in SCOP 1.75
  
• d2o14a2 appears in SCOPe 2.02
  
• d2o14a2 appears in the current release, SCOPe 2.08