Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) |
Family b.18.1.32: YxiM N-terminal domain-like [158963] (1 protein) PfamB PB038265 |
Protein Hypothetical protein YxiM [158964] (1 species) |
Species Bacillus subtilis [TaxId:1423] [158965] (1 PDB entry) Uniprot P42304 29-174 |
Domain d2o14a1: 2o14 A:14-159 [148544] Other proteins in same PDB: d2o14a2 complexed with mn, so4 |
PDB Entry: 2o14 (more details), 2.1 Å
SCOP Domain Sequences for d2o14a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]} kvyqfdfgsgsmepgyigvrasdrydrskgygfqtpenmrdvaasgagvksdaveflayg tksnntfnvdlpnglyevkvtlgntarasvaaegvfqvinmtgdgaedtfqipvtdgqln llvtegkagtaftlsalkikklsdqp
Timeline for d2o14a1: