SCOPe 2.08: Domain d2o14a1: 2o14 A:14-159

Lineage for d2o14a1 (2o14 A:14-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.32: YxiM N-terminal domain-like [158963] (1 protein)
   PfamB PB038265

6. Protein Hypothetical protein YxiM [158964] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [158965] (1 PDB entry)
   Uniprot P42304 29-174

8. Domain d2o14a1: 2o14 A:14-159 [148544]
   Other proteins in same PDB: d2o14a2
   complexed with mn, so4

Details for d2o14a1

PDB Entry: 2o14, 2.1 Å

PDB Description: x-ray crystal structure of protein yxim_bacsu from bacillus subtilis. northeast structural genomics consortium target sr595

PDB Compounds: (A:) Hypothetical protein yxiM

SCOPe Domain Sequences for d2o14a1:

Sequence; same for both SEQRES and ATOM records:

>d2o14a1 b.18.1.32 (A:14-159) Hypothetical protein YxiM {Bacillus subtilis [TaxId: 1423]}
kvyqfdfgsgsmepgyigvrasdrydrskgygfqtpenmrdvaasgagvksdaveflayg
tksnntfnvdlpnglyevkvtlgntarasvaaegvfqvinmtgdgaedtfqipvtdgqln
llvtegkagtaftlsalkikklsdqp

Timeline for d2o14a1:

• d2o14a1 first appeared in SCOP 1.75
  
• d2o14a1 appears in SCOPe 2.07